PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G473274_P01
Common NamebZIP64, ZEAMMB73_220218
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 337aa    MW: 36449.4 Da    PI: 5.5899
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G473274_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.71.6e-10198250557
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                        kr++r   NR +A rs +RK  +i+eLe+kv+ L++e +aL   l  l+  +a
  GRMZM2G473274_P01 198 KRAKRVLANRQSAARSKERKMRYIAELEQKVQILQTEATALSAHLTLLQRDSA 250
                        9*****************************************99999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-14194258IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.369196259IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.74E-10198248No hitNo description
Gene3DG3DSA:1.20.5.1708.3E-10198250No hitNo description
PfamPF001701.5E-9198250IPR004827Basic-leucine zipper domain
CDDcd147031.12E-21199250No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006340anatomyadult vascular leaf
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0020040anatomyleaf base
PO:0020126anatomytassel inflorescence
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MEAFAAQHQG DVCMEAVGVD TAAQQGPRPR TAHRRSRSDV PSGYYFGGEG HQLPPPKVEA  60
GWGGHLHGGG GDDDLFNAYL NLEGLDGLNS SDDRRQYYDG DSRGSSVRTN GADSSENDSE  120
ECAAAGPPVA HHVRSLSMDS SLIGKLNFSA GAAAANGGVI PGPNRFSLEF GSGEFTPVEM  180
NKIMADEKLA EMALADPKRA KRVLANRQSA ARSKERKMRY IAELEQKVQI LQTEATALSA  240
HLTLLQRDSA GIATQNNELQ FRLQAMAQQA QLRDALNEAL TAEVQRLKLA TAELGDSCSS  300
NSLAQQMQIQ LSAHDQTFEL HQQQAMPIAF YQLRQAQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.311830.0shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G473274
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G473274_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7281660.0KJ728166.1 Zea mays clone pUT6436 bZIP transcription factor (bZIP64) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008660544.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ69IL49e-48RF2A_ORYSJ; Transcription factor RF2a
TrEMBLK7WHC40.0K7WHC4_MAIZE; BZIP transcription factor
STRINGGRMZM2G473274_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.34e-61bZIP family protein